PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000222G1060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family M-type_MADS
Protein Properties Length: 160aa    MW: 18035.8 Da    PI: 11.1758
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000222G1060genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.31.6e-26108157251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      ri+nk+ rqvtfskRrng+lKKA+EL +LCdaeva+++fs+ g+++ +ss
  PH01000222G1060 108 RIDNKISRQVTFSKRRNGLLKKAYELAILCDAEVALVLFSHAGRVFQFSS 157
                      9***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056341.4E-1047113IPR023342APO domain
SMARTSM004326.6E-2752158IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-24101121IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-23105158IPR002100Transcription factor, MADS-box
CDDcd002654.59E-31107158No hitNo description
PROSITE profilePS5006625.609107159IPR002100Transcription factor, MADS-box
PfamPF003193.7E-25108155IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-24121136IPR002100Transcription factor, MADS-box
PRINTSPR004048.3E-24136157IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MPPTGLLAWQ AISARADALG RSLRPPLGTA ARRLHSGGET GGEEFPYADI PRPRRKWERK  60
PYVTPMKVLI WRDKEERRAR RENPCRVLDH PPGNGLLTSH LAEFAHQRID NKISRQVTFS  120
KRRNGLLKKA YELAILCDAE VALVLFSHAG RVFQFSSSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n6j_A5e-16108158959Myocyte-specific enhancer factor 2B
1n6j_B5e-16108158959Myocyte-specific enhancer factor 2B
1tqe_P4e-161081581060Myocyte-specific enhancer factor 2B
1tqe_Q4e-161081581060Myocyte-specific enhancer factor 2B
1tqe_R4e-161081581060Myocyte-specific enhancer factor 2B
1tqe_S4e-161081581060Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15155RPRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1883302e-64AY188330.1 Sorghum bicolor phytochelatin synthetase-like protein 1, phytochelatin synthetase-like protein 2, and cytochrome b5 (Cyb5) genes, complete cds; and MADS box protein AGLG1 (Aglg1) gene, partial cds.
GenBankEU9648952e-64EU964895.1 Zea mays clone 282407 MADS-box transcription factor 34 mRNA, complete cds.
GenBankJN6616062e-64JN661606.1 Chasmanthium latifolium panicle phytomer 2-like protein (PAP2) mRNA, partial cds.
GenBankKF4692992e-64KF469299.1 Brachypodium distachyon MADS-box transcription factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575155.11e-36PREDICTED: APO protein 3, mitochondrial
TrEMBLI1IAK91e-36I1IAK9_BRADI; Uncharacterized protein
STRINGBRADI3G45970.13e-36(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.35e-23MIKC_MADS family protein